A2756
AHCY Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A2756
- Zusätzliche Namen:
- adoHcyase|AHCY|SAHH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
- Uniprot:
- P23526
- Synonyme:
- adenosylhomocysteinase;adoHcyase;epididymis secretory sperm binding protein;S-adenosyl-L-homocysteine hydrolase;S-adenosylhomocysteine hydrolase;SAHH
- Weitere Details:
- S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice