PE Rabbit anti-Human CD353/SLAMF8 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27549
Zusätzliche Namen:: BLAME|CD353|SBBI42
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYD
Uniprot:: Q9P0V8
Synonyme:: B lymphocyte activator macrophage expressed;B-lymphocyte activator macrophage expressed;BCM-like membrane protein;BLAME;CD353;SBBI42;SLAM family member 8
Weitere Details:: This gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. This protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that it may function during B cell lineage commitment. The gene is found in a region of chromosome 1 containing many CD2 genes.