[KD Validated] KDM6A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27546
Zusätzliche Namen:: bA386N14.2|KABUK2|UTX
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 154-180kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQ
Uniprot:: O15550
Synonyme:: [histone H3]-trimethyl-L-lysine(27) demethylase 6A;bA386N14.2;bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX));histone demethylase UTX;KABUK2;lysine (K)-specific demethylase 6A;lysine-specific demethylase 6A;ubiquitously transcribed tetratricopeptide repeat protein X-linked;ubiquitously-transcribed TPR gene on the X chromosome;Ubiquitously-transcribed TPR protein on the X chromosome;Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein;UTX
Weitere Details:: This gene is located on the X chromosome and is the corresponding locus to a Y-linked gene which encodes a tetratricopeptide repeat (TPR) protein. The encoded protein of this gene contains a JmjC-domain and catalyzes the demethylation of tri/dimethylated histone H3. Multiple alternatively spliced transcript variants have been found for this gene.