A2754
GluR2+GluR3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A2754
- Zusätzliche Namen:
- GluA2|GluA3|gluR-2|gluR-B|GLUR-C|GluR-K2|GLUR-K3|GLUR2|GluR2+GluR3|GLUR3|GLURB|GLURC|HBGR2|iGluR3|MRX94|MRXSW|NEDLIB
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 98kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
- Uniprot:
- P42262, P42263
- Synonyme:
- AMPA-selective glutamate receptor 2;AMPA-selective glutamate receptor 3;dJ1171F9.1;GluA2;GluA3;gluR-2;gluR-3;gluR-B;GLUR-C;GluR-K2;GLUR-K3;GLUR2;GLUR3;GLURB;GLURC;glutamate receptor 2;glutamate receptor 3;glutamate receptor C;Glutamate receptor ionotropic, AMPA 2;Glutamate receptor ionotropic, AMPA 3;glutamate receptor subunit 3;glutamate receptor, ionotrophic, AMPA 3;glutamate receptor, ionotropic, AMPA 2;glutamate receptor, ionotropic, AMPA 3;HBGR2;MRX94;MRXSW;NEDLIB
- Weitere Details:
- Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels. These channels are assembled from 4 related subunits, GRIA1-4. The subunit encoded by this gene (GRIA2) is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to render the channel impermeable to Ca(2+). Human and animal studies suggest that pre-mRNA editing is essential for brain function, and defective GRIA2 RNA editing at the Q/R site may be relevant to amyotrophic lateral sclerosis (ALS) etiology. Alternative splicing, resulting in transcript variants encoding different isoforms, (including the flip and flop isoforms that vary in their signal transduction properties), has been noted for this gene.Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing at this locus results in different isoforms, which may vary in their signal transduction properties
- Versandbedingungen:
- Blue Ice