APC Rabbit anti-Mouse CD155/Pvr monoclonal antibody

Größe

Auf Anfrage

SKU:: A27530
Zusätzliche Namen:: 3830421F03Rik|CD155|D7Ertd458e|HVED|mE4|necl-5|PVS|Taa1|Tage4
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL
Uniprot:: Q91WP1
Synonyme:: 3830421F03Rik;CD155;D7Ertd458;D7Ertd458e;HVED;mE4;necl;Necl-5;NECL5;nectin-like protein 5;poliovirus receptor;PVS;Ta;Taa1;Tage;TAGE4;tumor-associated antigen 1
Weitere Details:: Enables dynein light chain binding activity. Acts upstream of or within cell migration and cell-cell adhesion. Located in cell surface and plasma membrane. Orthologous to human PVR (PVR cell adhesion molecule).