IMMT Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2751
Zusätzliche Namen:: HMP|IMMT|Mic60|MICOS60|MINOS2|P87|P87/89|P89|PIG4|PIG52
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 90kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKK
Uniprot:: Q16891
Synonyme:: cell proliferation-inducing gene 4/52 protein;cell proliferation-inducing protein 52;heart muscle protein;HMP;Mic60;MICOS complex subunit MIC60;MICOS60;MINOS2;mitochondrial contact site and cristae organizing system subunit 60;mitochondrial inner membrane organizing system 2;mitochondrial inner membrane protein;mitofilin;motor protein;P87;P87/89;P89;PIG4;PIG52;proliferation-inducing gene 4
Weitere Details:: Enables RNA binding activity. Involved in cristae formation. Located in mitochondrial inner membrane. Part of MICOS complex.