APC Rabbit anti-Human CD196/CCR6 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27385
Zusätzliche Namen:: BN-1|C-C CKR-6|CC-CKR-6|CCR-6|CD196|CKR-L3|CKRL3|CMKBR6|DCR2|DRY6|GPR29|GPRCY4|STRL22
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQE
Uniprot:: P51684
Synonyme:: BN-1;C-C chemokine receptor type 6;C-C CKR-6;CC-CKR-6;CCR-6;CD196;chemokine (C-C motif) receptor 6;chemokine (C-C) receptor 6;chemokine receptor-like 3;CKR-L3;CKRL3;CMKBR6;DCR2;DRY6;G protein-coupled receptor 29;G-protein coupled receptor 29;GPR-CY4;GPR29;GPRCY4;LARC receptor;seven-transmembrane receptor, lymphocyte, 22;STRL22
Weitere Details:: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligand of this receptor is macrophage inflammatory protein 3 alpha (MIP-3 alpha). This receptor has been shown to be important for B-lineage maturation and antigen-driven B-cell differentiation, and it may regulate the migration and recruitment of dentritic and T cells during inflammatory and immunological responses. Alternatively spliced transcript variants that encode the same protein have been described for this gene.

Versandbedingungen:: Blue Ice