CXCL10/IP-10 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27370
Zusätzliche Namen:: C7|crg-2|CXCL10/IP-10|gIP-10|IFI10|INP10|IP-10|mob-1|SCYB10
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 11kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Uniprot:: P02778
Synonyme:: 10 kDa interferon gamma-induced protein;C-X-C motif chemokine 10;C7;crg-2;gamma IP10;gIP-10;IFI10;INP10;interferon-inducible cytokine IP-10;IP-10;mob-1;protein 10 from interferon (gamma)-induced cell line;SCYB10;small inducible cytokine subfamily B (Cys-X-Cys), member 10;small-inducible cytokine B10
Weitere Details:: This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection.