Biotin Rabbit anti-Mouse CD28 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27359
Zusätzliche Namen:: Cd28
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
Uniprot:: P31041
Synonyme:: T-cell-specific surface glycoprotein CD28;Tp44
Weitere Details:: Enables protein kinase binding activity. Acts upstream of or within several processes, including positive regulation of immune response; positive regulation of intracellular signal transduction; and regulation of lymphocyte activation. Located in external side of plasma membrane and immunological synapse. Human ortholog(s) of this gene implicated in multiple sclerosis and type 1 diabetes mellitus. Orthologous to human CD28 (CD28 molecule).