MBTPS1 Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A27314PM
Zusätzliche Namen:: PCSK8|S1P|SEDKF|SKI-1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: LSIDLDKVVLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTPSV
Uniprot:: Q14703
Synonyme:: endopeptidase S1P;membrane-bound transcription factor site-1 protease;PCSK8;proprotein convertase subtilisin/kexin type 8;S1P;SEDKF;site-1 protease;SKI-1;subtilisin/kexin isozyme-1;Subtilisin/kexin-isozyme 1
Weitere Details:: This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction.

Versandbedingungen:: Blue Ice