A2731
GNA11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2731
- Zusätzliche Namen:
- FBH|FBH2|FHH2|GNA-11|GNA11|HG1K|HHC2|HYPOC2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
- Uniprot:
- P29992
- Synonyme:
- FBH;FBH2;FHH2;g alpha-11;GNA-11;guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide-binding protein G(y) subunit alpha;guanine nucleotide-binding protein subunit alpha-11;HHC2;HYPOC2
- Weitere Details:
- The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations.
- Versandbedingungen:
- Blue Ice





