Nucleophosmin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27297
Zusätzliche Namen:: B23|NPM
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEED
Uniprot:: P06748
Synonyme:: B23;NPM;Nucleolar phosphoprotein B23;nucleolar protein NO38;nucleophosmin;nucleophosmin (nucleolar phosphoprotein B23, numatrin);nucleophosmin/nucleoplasmin family, member 1;Numatrin;testicular tissue protein Li 128
Weitere Details:: The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified.