PE Rabbit anti-Mouse CD204 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27278
Zusätzliche Namen:: MRS-A|MSR|MSR-A|Scara1|Scvr|SR-A|SR-AI|SR-AII
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GSTPLKTVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Uniprot:: P30204
Synonyme:: CD204;macrophage acetylated LDL receptor I and II;macrophage scavenger receptor type III;macrophage scavenger receptor types I and II;MR;MRS-A;MS;MSR;MSR-A;phSR1;phSR2;S;Sc;SCARA1;scavenger receptor class A member 1;scavenger receptor type A;Scvr;SR-A;SR-AI;SR-AII;SR-AIII;SRA
Weitere Details:: Enables amyloid-beta binding activity; cargo receptor activity; and low-density lipoprotein particle binding activity. Involved in several processes, including endocytosis; positive regulation of cholesterol storage; and positive regulation of macrophage derived foam cell differentiation. Acts upstream of or within establishment of localization in cell and lipoprotein transport. Located in plasma membrane. Is expressed in several structures, including alimentary system; early conceptus; limb; neural tube; and reproductive system. Human ortholog(s) of this gene implicated in Barrett's esophagus; arteriosclerosis; and prostate cancer. Orthologous to human MSR1 (macrophage scavenger receptor 1).

Versandbedingungen:: Blue Ice