[KD Validated] OAT Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27191
Zusätzliche Namen:: GACR|HOGA|OATASE|OKT
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF
Uniprot:: P04181
Synonyme:: GACR;gyrate atrophy;HOGA;OATASE;OKT;ornithine aminotransferase, mitochondrial;ornithine delta-aminotransferase;Ornithine--oxo-acid aminotransferase;ornithine-oxo-acid aminotransferase;testicular tissue protein Li 130
Weitere Details:: This gene encodes the mitochondrial enzyme ornithine aminotransferase, which is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Alternatively spliced transcript variants encoding different isoforms have been described. Related pseudogenes have been defined on the X chromosome.

Versandbedingungen:: Blue Ice