[KD Validated] LAP3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27188
Zusätzliche Namen:: HEL-S-106|LAP|LAPEP|PEPS
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 56kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS
Uniprot:: P28838
Synonyme:: cysteinylglycine-S-conjugate dipeptidase;cytosol aminopeptidase;epididymis secretory protein Li 106;HEL-S-106;LAP;LAPEP;Leucine aminopeptidase 3;leucyl aminopeptidase;PEPS;peptidase S;proline aminopeptidase;prolyl aminopeptidase
Weitere Details:: Predicted to enable peptidase activity. Predicted to be involved in proteolysis. Located in cytosol; midbody; and nucleoplasm.