PerCP/Cyanine5.5 Rabbit anti-Mouse Ly-6A/E (Sca-1) monoclonal antibody

Größe

Auf Anfrage

SKU:: A27185
Zusätzliche Namen:: Ly-6A.2|Ly-6A/E|Ly-6E.1|Sca-1|Sca1|TAP
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG
Uniprot:: P08648
Synonyme:: CD49 antigen-like family member E;CD49e;fibronectin receptor subunit alpha;fibronectin receptor, alpha polypeptide;fibronectin receptor, alpha subunit;FNRA;integrin alpha-5;integrin alpha-F;integrin, alpha 5 (fibronectin receptor, alpha polypeptide);ITGA5/SLC9B1 fusion;Ly-6A;Ly-6A.2;Ly-6A/E;Ly-6E.;Ly-6E.1;lymphocyte antigen 6A-2/6E-1;Sc;Sca;Sca-1;Sca1;stem cell antigen 1;T;T-cell-activating protein;TAP;very late activation protein 5, alpha subunit;VLA-5;VLA5A
Weitere Details:: T-cell activation.Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).