ABflo[R] 488 Rabbit anti-Mouse CD40 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27175
Zusätzliche Namen:: Bp50|GP39|HIGM1|IGM|IMD3|p50|T-BAM|Tnfrsf5|TRAP
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLK
Uniprot:: P27512
Synonyme:: AI326936;B cell surface antigen CD40;B cell-associated molecule;B-cell surface antigen CD40;Bp5;Bp50;CD40 molecule, TNF receptor superfamily member 5;CD40L receptor;CDW40;GP39;HIGM1;IGM;IMD3;p5;p50;T-BAM;T-cell differentiation antigen;Tnfr;TNFRSF5;TRAP;tumor necrosis factor receptor superfamily member 5
Weitere Details:: Predicted to enable antigen binding activity; protein domain specific binding activity; and ubiquitin protein ligase binding activity. Involved in B cell mediated immunity; CD40 signaling pathway; and cellular calcium ion homeostasis. Acts upstream of or within several processes, including defense response to other organism; positive regulation of B cell activation; and positive regulation of interleukin-12 production. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Part of CD40 receptor complex. Is expressed in several structures, including alimentary system; brain; hemolymphoid system gland; liver and biliary system; and reproductive system. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; autoimmune disease (multiple); end stage renal disease; hyperimmunoglobulin syndrome (multiple); and non-Hodgkin lymphoma (multiple). Orthologous to human CD40 (CD40 molecule).

Versandbedingungen:: Blue Ice