A27148
LYVE1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A27148
- Zusätzliche Namen:
- 1200012G08Rik|Crsbp-1|Lyve-1|Lyve1|Xlkd1
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 55-70kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG
- Uniprot:
- Q8BHC0
- Synonyme:
- 1200012G08Rik;cell surface retention sequence binding protein-1;Cell surface retention sequence-binding protein 1;CRSBP-1;extra cellular link domain-containing 1;extracellular link domain-containing 1;extracellular link domain-containing protein 1;HAR;hyaluronic acid receptor;lymphatic vessel endothelial HA receptor-1;lymphatic vessel endothelial HA recptor-1;lymphatic vessel endothelial hyaluronic acid receptor 1;Lyve;LYVE-1;Xlkd;XLKD1
- Weitere Details:
- Enables hyaluronic acid binding activity and transmembrane signaling receptor activity. Acts upstream of or within glycosaminoglycan catabolic process. Located in plasma membrane. Is expressed in several structures, including cardiovascular system; gut; hemolymphoid system; meninges; and metanephros. Orthologous to human LYVE1 (lymphatic vessel endothelial hyaluronan receptor 1).
- Versandbedingungen:
- Blue Ice