CLEC4D Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2697
Zusätzliche Namen:: CD368|CLEC-6|CLEC4D|CLEC6|CLECSF8|Dectin-3|MCL|MPCL
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 27 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Uniprot:: Q8WXI8
Synonyme:: C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 8;C-type lectin domain family 4 member D;C-type lectin receptor;C-type lectin superfamily member 8;C-type lectin-like receptor 6;CD368;CLEC-6;CLEC6;CLECSF8;DC-associated C-type lectin 3;Dectin 3;Dectin-3;dendritic cell-associated C-type lectin 3;macrophage C-type lectin;MCL;MPCL
Weitere Details:: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Versandbedingungen:: Blue Ice