[KD Validated] XPNPEP3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26950
Zusätzliche Namen:: APP3|ICP55|NPHPL1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSK
Uniprot:: Q9NQH7
Synonyme:: Aminopeptidase P3;APP3;ICP55;Intermediate Cleaving Peptidase 55;NPHPL1;probable Xaa-Pro aminopeptidase 3;X-Pro aminopeptidase 3;X-prolyl aminopeptidase 3, mitochondrial;xaa-Pro aminopeptidase 3
Weitere Details:: The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known.