A2693
TrkA+B+C Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A2693
- Zusätzliche Namen:
- DEE58|EIEE58|GP145-TrkB|GP145-TrkC|gp145(trkC)|MTC|OBHD|p140-TrkA|TRK|Trk-A|trk-B|TRK1|TRKA|TrkA+B+C|TRKB|TRKC
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 140 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
- Uniprot:
- P04629, Q16288, Q16620
- Synonyme:
- BDNF-tropomyosine receptor kinase B;BDNF/NT-3 growth factors receptor;DEE58;EIEE58;ETS related protein-neurotrophic receptor tyrosine kinase fusion protein;ETV6-NTRK3 fusion;gp140trk;GP145-TrkB;GP145-TrkC;gp145(trkC);high affinity nerve growth factor receptor;MTC;Neurotrophic tyrosine kinase receptor type 1;neurotrophic tyrosine kinase receptor type 2;Neurotrophic tyrosine kinase receptor type 3;neurotrophic tyrosine kinase, receptor, type 1;neurotrophic tyrosine kinase, receptor, type 3;NT-3 growth factor receptor;OBHD;Oncogene TRK;p140-TrkA;TRK;Trk-A;trk-B;TRK1;TRK1-transforming tyrosine kinase protein;TRKA;TRKB;TrkB tyrosine kinase;TRKC;TrkC tyrosine kinase;tropomyosin-related kinase A;tropomyosin-related kinase B;Tyrosine kinase receptor;tyrosine kinase receptor A;tyrosine kinase receptor B;tyrosine kinase receptor C
- Weitere Details:
- This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice








