[KD Validated] ETFDH Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26878
Zusätzliche Namen:: ETFQO|MADD
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 64kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM
Uniprot:: Q16134
Synonyme:: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial;electron-transferring-flavoprotein dehydrogenase;ETF dehydrogenase;ETF-QO;ETF-ubiquinone oxidoreductase;ETFQO;MADD;mutant electron transfer flavoprotein dehydrogenase
Weitere Details:: This gene encodes a component of the electron-transfer system in mitochondria and is essential for electron transfer from a number of mitochondrial flavin-containing dehydrogenases to the main respiratory chain. Mutations in this gene are associated with glutaric acidemia. Alternatively spliced transcript variants that encode distinct isoforms have been observed.