PE Rabbit anti-Human IgA1 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26802
Zusätzliche Namen:: IgA1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
Uniprot:: P01876
Synonyme:: Ig alpha-1 chain C region;Ig alpha-1 chain C region BUR;Ig alpha-1 chain C region TRO;IgA1;immunoglobulin alpha 1;immunoglobulin heavy chain constant region alpha 1
Weitere Details:: Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. In normal adult serum, the approximate percentage composition of IgA with respect to is subclasses is IgA1:90% and IgA2:10%. In secretory IgA, the subclass proportions may approach 50:50. The clinical significance of the subclasses has yet to be determined.