Cytokeratin AE3 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A26789
Zusätzliche Namen:: AEI2|CK1|EHK|EHK1|EPPK|K1|KRT1A|NEPPK
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 28-60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNA
Uniprot:: P02538, P04264, P08729, P12035, P13647, P19013, P35908
Synonyme:: 58 kda cytokeratin;65 kDa cytokeratin;67 kDa cytokeratin;CARD2;CK-1;CK-2e;CK-3;CK-4;CK-5;CK-6C;CK-6E;CK-7;CK-8;CK1;CK3;CK4;CK5;CK6A;CK6C;CK6D;CK7;CK8;CYK4;CYK8;cytokeratin 1;cytokeratin 3;cytokeratin 4;cytokeratin 6A;cytokeratin 6C;cytokeratin 6D;cytokeratin 7;Cytokeratin-1;cytokeratin-2e;Cytokeratin-3;Cytokeratin-4;cytokeratin-5;Cytokeratin-6A;Cytokeratin-6D;Cytokeratin-7;cytokeratin-8;DDD;DDD1;EBS2;EHK;EHK1;epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types;epidermolytic hyperkeratosis 1;epithelial keratin-2e;EPPK;hair alpha protein;K1;K2C7;K2C8;K2e;K3;K4;K5;K6A;K6C;K6D;K7;K8;keratin 1, type II;keratin 2, type II;keratin 3, type II;keratin 4, type II;keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types);keratin 5, type II;keratin 6A, , type II;keratin 6A, type II;keratin 7, type II;keratin 8, type II;Keratin-1;keratin-2 epidermis;keratin-2e;Keratin-3;Keratin-4;Keratin-5;Keratin-6A;Keratin-7;keratin, 55K type II cytoskeletal;keratin, epidermal type II, K6A;keratin, simple epithelial type I, K7;keratin, type II cytoskeletal 1;keratin, type II cytoskeletal 2 epidermal;keratin, type II cytoskeletal 3;keratin, type II cytoskeletal 4;keratin, type II cytoskeletal 5;keratin, type II cytoskeletal 6A;keratin, type II cytoskeletal 7;keratin, type II cytoskeletal 8;KO;KRT1A;KRT2A;KRT2E;KRT5A;KRT6C;KRT6D;KRTE;MECD2;NEPPK;PC3;sarcolectin;SCL;type II mesothelial keratin K7;type-II keratin Kb1;type-II keratin Kb2;type-II keratin Kb3;type-II keratin Kb4;type-II keratin Kb5;type-II keratin Kb6;type-II keratin Kb7;type-II keratin Kb8;WSN1
Weitere Details:: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Versandbedingungen:: Blue Ice