ABflo[R] 488 Conjugated TOM20 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26783
Zusätzliche Namen:: MAS20|MOM19|TOM20
Anwendung:: WB, IF, ICC
Molekulargewicht:: 16 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Uniprot:: Q15388
Synonyme:: MAS20;mitochondrial 20 kDa outer membrane protein;mitochondrial import receptor subunit TOM20 homolog;MOM19;outer mitochondrial membrane receptor Tom20;TOM20;translocase of outer mitochondrial membrane 20 homolog type II
Weitere Details:: Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane.