A26775
Aurora B Mouse monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A26775
- Zusätzliche Namen:
- AIK2|AIM-1|AIM1|ARK-2|ARK2|AurB|aurkb-sv1|aurkb-sv2|IPL1|PPP1R48|STK-1|STK12|STK5
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Mouse
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
- Uniprot:
- Q96GD4
- Synonyme:
- AIK2;AIM-1;AIM1;ARK-2;ARK2;AurB;aurkb-sv1;aurkb-sv2;Aurora 1;aurora kinase B;aurora kinase B-Sv1;aurora kinase B-Sv2;aurora- and Ipl1-like midbody-associated protein 1;aurora-1;aurora-B;aurora-related kinase 2;aurora/IPL1-related kinase 2;IPL1;PPP1R48;protein phosphatase 1, regulatory subunit 48;serine/threonine kinase 12;serine/threonine-protein kinase 12;serine/threonine-protein kinase 5;serine/threonine-protein kinase aurora-B;STK-1;STK12;STK5
- Weitere Details:
- This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice








