[KO Validated] Ki67 Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A26755PM
Zusätzliche Namen:: KIA|MIB-|MIB-1|PPP1R105
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 359kDa or below
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PAGGDEKDMKAFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSPQPDPVDTPASTKQRPKRNLRKADVE
Uniprot:: E9PVX6
Synonyme:: antigen identified by monoclonal antibody Ki-67 homolog;antigen KI-67 homolog;antigen Ki67 homolog;D630048A14Rik;Ki-6;Ki-67;Ki6;Ki67;proliferation marker protein Ki-67
Weitere Details:: Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.