CD11b Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A26754PM
Zusätzliche Namen:: CD11B|CR3A|MAC-1|MAC1A|MO1A|SLEB6
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 170 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPP
Uniprot:: P05555, P11215
Synonyme:: antigen CD11b (p170);CD11 antigen-like family member B;CD11B;CD11B (p170);CD11b/CD18;cell surface glycoprotein MAC-1 alpha subunit;cell surface glycoprotein MAC-1 subunit alpha;complement component 3 receptor 3 subunit;complement receptor type 3;CR;CR-3 alpha chain;CR3;CR3A;F730045J24Rik;integrin alpha-M;integrin, alpha M (complement component 3 receptor 3 subunit);leukocyte adhesion receptor MO1;Ly-4;Ly-40;Mac-;MAC-1;Mac-1 alpha;Mac-1a;MAC1;MAC1A;macrophage antigen alpha;macrophage antigen alpha polypeptide;macrophage-1 antigen alpha subunit;MO1A;Neutrophil adherence receptor;neutrophil adherence receptor alpha-M subunit;SLEB6
Weitere Details:: This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice