A26753PM
Survivin Rabbit PolymAb[R]

Größe
Auf Anfrage
- SKU:
- A26753PM
- Zusätzliche Namen:
- API4|EPR-1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 16 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD
- Uniprot:
- O15392
- Synonyme:
- API4;apoptosis inhibitor 4;apoptosis inhibitor survivin;baculoviral IAP repeat-containing protein 5;EPR-1;survivin variant 3 alpha
- Weitere Details:
- This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice
![Survivin Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26753PM/A26753PM_1.jpg)
![Survivin Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26753PM/A26753PM_2.jpg)
![Survivin Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26753PM/A26753PM_ARC0259_ARC54648-01(2比3)_WB_01.jpg)
![Survivin Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26753PM/A26753PM_ARC0259_ARC54648-01(2比3)_WB_02.jpg)