PE Rabbit anti-Mouse CD80/B7-1 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26740
Zusätzliche Namen:: B71|Cd28l|Ly-53|Ly53|MIC17|TSA1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK
Uniprot:: Q00609
Synonyme:: activation B7-1 antigen;B-lymphocyte activation antigen B7;B7;B7 protein;B7-1;B7.1;B71;BB1;Cd28;Cd28l;CD28LG;CD28LG1;CD80 antigen (CD28 antigen ligand 1, B7-1 antigen);costimulatory factor CD80;costimulatory molecule variant IgV-CD80;CTLA-4 counter-receptor B7.1;LAB7;Ly-5;Ly-53;Ly5;Ly53;MIC17;T-lymphocyte activation antigen CD80;TSA1
Weitere Details:: Predicted to enable coreceptor activity. Acts upstream of or within T cell costimulation; cellular response to lipopolysaccharide; and positive regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is expressed in heart ventricle and skin. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human CD80 (CD80 molecule).