ABflo[R] 488 Rabbit anti-Human CD52 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26721
Zusätzliche Namen:: CDW52|EDDM5|HE5
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Uniprot:: P31358
Synonyme:: cambridge pathology 1 antigen;CAMPATH-1 antigen;CD52 antigen (CAMPATH-1 antigen);CDW52;CDW52 antigen (CAMPATH-1 antigen);EDDM5;epididymal secretory protein E5;epididymis secretory sperm binding protein Li 171mP;HE5;HEL-S-171mP;human epididymis-specific protein 5
Weitere Details:: Involved in positive regulation of cytosolic calcium ion concentration. Predicted to be located in extracellular region and plasma membrane. Predicted to be intrinsic component of plasma membrane. Predicted to be active in sperm midpiece.