PE Rabbit anti-Mouse Ly-49D monoclonal antibody

Größe

Auf Anfrage

SKU:: A26717
Zusätzliche Namen:: Chok|Klra32|Klra33|Ly-49d|Ly49d|ly49r<129>
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TNIFQYGQQKHELKEFLKHHNNCSIMQSDINLKDELLKNKSIECNLLESLNRDQNILCDKTRTVLDYLQHTGRGVKVYWFCYGMKCYYFVMDRKPWSRCKQSCQNSSLTLLKIDDEDELKFLQLVVPSDSCWIGLSYDNKKKDWAWIDNRPSKLALNTTKYNIRDGGCMFLSKTRLDNNYCDQSFICICGKRLDKFPH
Uniprot:: Q60651
Synonyme:: Cho;Chok;killer cell lectin-like receptor 4;killer cell lectin-like receptor subfamily A member 32;killer cell lectin-like receptor subfamily A member 33;Klra32;Klra33;Ly-49d;Ly49;Ly49d;ly49r<12;ly49r<129>;lymphocyte antigen 49d;T-cell surface glycoprotein Ly-49D
Weitere Details:: Predicted to enable carbohydrate binding activity. Predicted to act upstream of or within cell adhesion. Located in external side of plasma membrane.