PE Rabbit anti-Mouse CD62L/L-Selectin monoclonal antibody

Größe

Auf Anfrage

SKU:: A26715
Zusätzliche Namen:: CD62L|L-selectin|LAM-1|LECAM-1|LECAM1|Lnhr|Ly-22|Ly-m22|Lyam-1|Lyam1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN
Uniprot:: P18337
Synonyme:: AI528707;CD62;CD62 antigen-like family member L;CD62L;gp90-MEL;L;L-sel;L-selectin;LAM-1;LAM1;LECAM;LECAM-1;LECAM1;LEU8;leukocyte adhesion molecule 1;leukocyte surface antigen Leu-8;leukocyte-endothelial cell adhesion molecule 1;LNHR;LSEL;Ly-2;Ly-22;Ly-m2;Ly-m22;Lya;Lyam;Lyam-1;LYAM1;lymph node homing receptor;lymphocyte adhesion molecule 1;lymphocyte antigen 22;lymphocyte surface MEL-14 antigen;pln homing receptor;PLNHR;TQ1
Weitere Details:: Enables cell adhesion molecule binding activity. Acts upstream of or within response to ATP. Located in external side of plasma membrane. Is expressed in brain; brainstem; submandibular gland epithelium; and testis. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in Crohn's disease; IgA glomerulonephritis; and ulcerative colitis. Orthologous to human SELL (selectin L).

Versandbedingungen:: Blue Ice