PE Rabbit anti-Mouse CD88/C5aR monoclonal antibody

Größe

Auf Anfrage

SKU:: A26709
Zusätzliche Namen:: C5aR|C5r1|Cd88|D7Msu1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGD
Uniprot:: P30993
Synonyme:: C5;C5A;C5a anaphylatoxin chemotactic receptor;C5a anaphylatoxin chemotactic receptor 1;C5a anaphylatoxin receptor;C5a ligand;C5a-R;C5AR;C5r;C5R1;CD88;complement component 5, receptor 1;complement component 5a receptor 1;D7Msu;D7Msu1
Weitere Details:: Enables complement component C5a receptor activity. Involved in several processes, including astrocyte activation; positive regulation of vascular endothelial growth factor production; and regulation of granulocyte chemotaxis. Acts upstream of or within defense response to Gram-positive bacterium; neutrophil chemotaxis; and response to peptidoglycan. Predicted to be located in several cellular components, including apical part of cell; basolateral plasma membrane; and cell surface. Predicted to be active in plasma membrane. Is expressed in several structures, including brain; liver; neural ectoderm; and sensory organ. Orthologous to several human genes including OPRPN (opiorphin prepropeptide).