PE Rabbit anti-Mouse CD140b/PDGFRB Beta monoclonal antibody

Größe

Auf Anfrage

SKU:: A26689
Zusätzliche Namen:: CD140b|Pdgfr|PDGFR-1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFK
Uniprot:: P05622
Synonyme:: Activated tyrosine kinase PDGFRB;AI528809;beta platelet-derived growth factor receptor;beta-type platelet-derived growth factor receptor;CD140 antigen-like family member B;CD140B;IBGC4;IMF1;JTK12;KOGS;NDEL1-PDGFRB;Pdg;PDGF beta chain;PDGF-R-beta;PDGFR;PDGFR-1;PDGFR-beta;PDGFR1;PENTT;platelet-derived growth factor receptor 1;platelet-derived growth factor receptor beta;platelet-derived growth factor receptor beta variant 1;platelet-derived growth factor receptor, beta polypeptide
Weitere Details:: Enables platelet-derived growth factor-activated receptor activity and signaling receptor binding activity. Involved in several processes, including positive regulation of intracellular signal transduction; protein phosphorylation; and vasculature development. Acts upstream of or within several processes, including animal organ development; response to ceramide; and ruffle assembly. Located in cell surface; cytoplasm; and ruffle. Is expressed in several structures, including alimentary system; extraembryonic component; genitourinary system; nervous system; and sensory organ. Used to study basal ganglia calcification; infantile myofibromatosis; myeloproliferative neoplasm; and severe nonproliferative diabetic retinopathy. Human ortholog(s) of this gene implicated in basal ganglia calcification; glioblastoma; infantile myofibromatosis; myeloproliferative neoplasm (multiple); and renal cell carcinoma. Orthologous to human PDGFRB (platelet derived growth factor receptor beta).

Versandbedingungen:: Blue Ice