CD1d Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26678
Zusätzliche Namen:: CD1.1|Cd1a|Cd1d|Ly-38
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 38 kDa (unglycosylation)/55 kDa (glycosylation)
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVG
Uniprot:: P11609, P11610
Synonyme:: AI747460;antigen-presenting glycoprotein CD1d;antigen-presenting glycoprotein CD1d1;antigen-presenting glycoprotein CD1d2;Cd1;CD1.1;CD1.2;CD1A;Cd1b;Cd1d;CD1D antigen, d polypeptide;differentiation antigen CD1-alpha-3;HMC class I antigen-like glycoprotein CD1D;Ly-3;Ly-38;R3;R3G1;T-cell surface glycoprotein CD1d;T-cell surface glycoprotein CD1d1;T-cell surface glycoprotein CD1d2;thymocyte antigen CD1D
Weitere Details:: Enables T cell receptor binding activity and endogenous lipid antigen binding activity. Involved in NK T cell differentiation and regulation of immature T cell proliferation in thymus. Acts upstream of or within several processes, including antigen processing and presentation, exogenous lipid antigen via MHC class Ib; positive regulation of cytokine production; and positive regulation of leukocyte activation. Located in endosome; external side of plasma membrane; and lysosome. Is expressed in forebrain; intestine; jaw bone; and liver. Human ortholog(s) of this gene implicated in pulmonary tuberculosis. Orthologous to human CD1D (CD1d molecule).

Versandbedingungen:: Blue Ice