FGF1 Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A26623PM
Zusätzliche Namen:: AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-1|FGF-alpha|FGFA|GLIO703|HBGF-1|HBGF1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Uniprot:: P05230
Synonyme:: Acidic fibroblast growth factor;AFGF;beta-endothelial cell growth factor;ECGF;ECGF-beta;ECGFA;ECGFB;Endothelial cell growth factor;endothelial cell growth factor, alpha;endothelial cell growth factor, beta;FGF-1;FGF-alpha;FGFA;fibroblast growth factor 1;fibroblast growth factor 1 (acidic);GLIO703;HBGF-1;HBGF1;heparin-binding growth factor 1
Weitere Details:: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.

Versandbedingungen:: Blue Ice