Cytokeratin AE1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A26614
Zusätzliche Namen:: BCIE|BIE|CK10|EHK|IHL|K10|KPP
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYY
Uniprot:: P02533, P08727, P08779, P13645, P19012
Synonyme:: 40-kDa keratin intermediate filament;BCIE;BIE;CK-10;CK-15;CK-19;CK10;CK14;CK15;CK16;CK19;cytokeratin 10;cytokeratin 14;cytokeratin 15;cytokeratin 16;cytokeratin 19;Cytokeratin-10;Cytokeratin-14;Cytokeratin-15;Cytokeratin-16;Cytokeratin-19;EBS3;EBS4;EHK;FNEPPK;focal non-epidermolytic palmoplantar keratoderma;K10;K14;K15;K16;K19;K1CO;K1CP;K1CS;keratin 10, type I;keratin 14, type I;keratin 15, type I;keratin 16, type I;keratin 19, type I;Keratin-10;Keratin-14;Keratin-15;keratin-15, basic;keratin-15, beta;Keratin-16;Keratin-19;keratin, type I cytoskeletal 10;keratin, type I cytoskeletal 14;keratin, type I cytoskeletal 15;keratin, type I cytoskeletal 16;keratin, type I cytoskeletal 19;keratin, type I, 40-kd;KPP;KRT16A;NEPPK;NFJ;PC1;type I cytoskeletal 15
Weitere Details:: This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21.

Versandbedingungen:: Blue Ice