PE Rabbit anti-Mouse CD87 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26599
Zusätzliche Namen:: Cd87|u-PAR|uPAR
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT
Uniprot:: P35456
Synonyme:: CD87;monocyte activation antigen Mo3;u;u-;U-PAR;u-plasminogen activator receptor form 2;UPAR;URKR;urokinase plasminogen activator receptor;urokinase plasminogen activator surface receptor;urokinase-type plasminogen activator (uPA) receptor
Weitere Details:: Predicted to enable enzyme binding activity; protein domain specific binding activity; and signaling receptor binding activity. Predicted to be involved in several processes, including negative regulation of apoptotic signaling pathway; positive regulation of epidermal growth factor receptor signaling pathway; and positive regulation of release of cytochrome c from mitochondria. Is integral component of plasma membrane. Is expressed in several structures, including decidua; early conceptus; and spleen. Human ortholog(s) of this gene implicated in rheumatoid arthritis. Orthologous to human PLAUR (plasminogen activator, urokinase receptor).

Versandbedingungen:: Blue Ice