ABflo[R] 700 Rabbit anti-Human CD337/NKp30 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26577
Zusätzliche Namen:: 1C7|CD337|LY117|MALS|NKp30
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Uniprot:: O14931
Synonyme:: 1C7;activating natural killer receptor p30;activating NK-A1 receptor;CD337;LY117;lymphocyte antigen 117;MALS;natural cytotoxicity triggering receptor 3;natural killer cell p30-related protein;NK-p30;NKp30
Weitere Details:: The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.