PE Rabbit anti-Mouse PD-L2/CD273/B7-DC monoclonal antibody

Größe

Auf Anfrage

SKU:: A26554
Zusätzliche Namen:: B7-DC|Btdc|F730015O22Rik|PD-L2
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASY
Uniprot:: Q9WUL5
Synonyme:: B7 dendritic cell molecule;B7-DC;B7DC;bA574F11.2;Btdc;butyrophilin B7-DC;butyrophilin-like protein;CD273;F730015O22Rik;PD-;PD-1 ligand 2;PD-1-ligand 2;PD-L2;PDCD1 ligand 2;PDCD1L2;PDL2;programmed cell death 1 ligand 2;programmed death ligand 2
Weitere Details:: Acts upstream of or within negative regulation of T cell proliferation and positive regulation of T cell proliferation. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system epithelium; forebrain; nose; retina; and skin. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2).