PerCP Rabbit anti-Mouse CD209b/DC-SIGNR1 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26547
Zusätzliche Namen:: 1810030I22Rik|DC-SIGNR1|mSIGNR1|OtB7|SIGNR1
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG
Uniprot:: Q8CJ91
Synonyme:: 1810030I22Rik;C-type lectin domain family 4 member L;CD209 antigen;CD209 antigen-like protein B;CDSIGN;CLEC4L;DC-SIGN;DC-SIGN-related protein 1;DC-SIGN1;DC-SIGNR1;dendritic cell-specific ICAM-3-grabbing non-integrin 1;dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin;dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin;hDC-SIGN;HIV gpl20-binding protein;mSI;mSIGNR1;OtB7;SI;SIGNR1
Weitere Details:: CD209B, also known as SIGN-R1, is a mouse C-type lectin receptor predominantly expressed on macrophages in the spleen marginal zone and lymph nodes medulla. CD209B is a mouse homolog of human CD209/DC-SIGN and is involved in innate immune response. CD209B mediates the recognition and uptake of pathogen products, such as lipopolysaccharides (LPS), pneumococcal polysaccharides, and dextrans. CD209B has been demonstrated to facilitate the clearance of encapsulated pneumococcus by directly binding to C1q and activating complement through an immunoglobulin independent pathway.

Versandbedingungen:: Blue Ice