PE Rabbit anti-Mouse CD124/IL-4RA Alpha monoclonal antibody

Größe

Auf Anfrage

SKU:: A26537
Zusätzliche Namen:: CD124|Il4r
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR
Uniprot:: P16382
Synonyme:: CD124;I;IL-4 receptor alpha chain;IL-4 receptor subunit alpha;IL-4R subunit alpha;IL-4R-alpha;IL-4RA;Il4r;IL4R nirs variant 1;IL4RA;interleukin 13 receptor;interleukin-4 receptor alpha chain;interleukin-4 receptor subunit alpha
Weitere Details:: Predicted to enable cytokine receptor activity. Involved in positive regulation of chemokine production; positive regulation of cold-induced thermogenesis; and positive regulation of macrophage activation. Acts upstream of or within several processes, including defense response to protozoan; negative regulation of T-helper 1 cell differentiation; and positive regulation of immune effector process. Predicted to be located in several cellular components, including centriolar satellite; extracellular space; and nucleoplasm. Predicted to be part of receptor complex. Is expressed in several structures, including adrenal medulla; early conceptus; hemolymphoid system; medulla oblongata basal plate mantle layer; and reproductive system. Used to study asthma. Human ortholog(s) of this gene implicated in several diseases, including acne; allergic conjunctivitis; autoimmune disease (multiple); human immunodeficiency virus infectious disease; and renal tuberculosis. Orthologous to human IL4R (interleukin 4 receptor).

Versandbedingungen:: Blue Ice