PE Rabbit anti-Human CD39/ENTPD1 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26520
Zusätzliche Namen:: ATPDase|CD39|NTPDase-1|SPG64
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGK
Uniprot:: P49961
Synonyme:: ATPDase;CD39;CD39 antigen;ecto-apyrase;ecto-ATP diphosphohydrolase 1;ecto-ATPase 1;ecto-ATPDase 1;ectonucleoside triphosphate diphosphohydrolase 1;lymphoid cell activation antigen;NTPDase-1;SPG64
Weitere Details:: The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene.