ABflo[R] 450 Rabbit anti-Human CD66b/CEACAM8 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26461
Zusätzliche Namen:: CD66b|CD67|CGM6|NCA-95
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
Uniprot:: P31997
Synonyme:: carcinoembryonic antigen CGM6;carcinoembryonic antigen gene family member 6;carcinoembryonic antigen related cell adhesion molecule 8;carcinoembryonic antigen-related cell adhesion molecule 8;CD66b;CD67;CD67 antigen;CGM6;NCA-95;non-specific cross-reacting antigen NCA-95
Weitere Details:: Enables protein heterodimerization activity. Involved in heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules. Located in cell surface and extracellular space. Biomarker of severe acute respiratory syndrome.