CaSR Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26435
Zusätzliche Namen:: CAR|EIG8|FHH|FIH|GPRC2A|hCasR|HHC|HHC1|HYPOC1|NSHPT|PCAR1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 120-260kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQY
Uniprot:: P41180
Synonyme:: CAR;EIG8;extracellular calcium-sensing receptor;FHH;FIH;GPRC2A;hCasR;HHC;HHC1;HYPOC1;NSHPT;parathyroid Ca(2+)-sensing receptor 1;parathyroid cell calcium-sensing receptor 1;PCAR1
Weitere Details:: The protein encoded by this gene is a plasma membrane G protein-coupled receptor that senses small changes in circulating calcium concentration. The encoded protein couples this information to intracellular signaling pathways that modify parathyroid hormone secretion or renal cation handling, and thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene are a cause of familial hypocalciuric hypercalcemia, neonatal severe hyperparathyroidism, and autosomal dominant hypocalcemia.