GLDC Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A26427PM
Zusätzliche Namen:: GCE|GCSP|HYGN1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 113kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSH
Uniprot:: P23378
Synonyme:: GCE;GCSP;Glycine cleavage system P protein;glycine cleavage system protein P;Glycine decarboxylase;glycine decarboxylase P-protein;glycine dehydrogenase (aminomethyl-transferring);glycine dehydrogenase (decarboxylating), mitochondrial;glycine dehydrogenase [decarboxylating], mitochondrial;HYGN1;nonketotic hyperglycinemia
Weitere Details:: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).

Versandbedingungen:: Blue Ice