ABflo[R] 488 Rabbit anti-Human CD88/C5aR monoclonal antibody

Größe

Auf Anfrage

SKU:: A26403
Zusätzliche Namen:: C5A|C5AR|C5R1|CD88
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHH
Uniprot:: P21730
Synonyme:: C5A;C5a anaphylatoxin chemotactic receptor;C5a anaphylatoxin chemotactic receptor 1;C5a anaphylatoxin receptor;C5a ligand;C5a-R;C5AR;C5R1;CD88;complement component 5a receptor 1
Weitere Details:: Enables G protein-coupled receptor activity and complement component C5a receptor activity. Involved in several processes, including complement component C5a signaling pathway; mRNA transcription by RNA polymerase II; and positive regulation of ERK1 and ERK2 cascade. Located in apical part of cell and basolateral plasma membrane. Biomarker of Alzheimer's disease; asthma; chronic obstructive pulmonary disease; rhinitis; and severe acute respiratory syndrome.