A2634
APLP1 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A2634
- Zusätzliche Namen:
- APLP|APLP1
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 100 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE
- Uniprot:
- P51693
- Synonyme:
- amyloid beta (A4) precursor-like protein 1;amyloid precursor-like protein 1;amyloid-like protein 1;APLP
- Weitere Details:
- This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice



_WB_01.jpg)
_IF_01.jpg)
_IF_02.jpg)