PE Rabbit anti-Mouse IL-9 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26265
Zusätzliche Namen:: Il-9|P40
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCN
Uniprot:: P15247
Synonyme:: cytokine P40;homolog of mouse T cell and mast cell growth factor 40;HP40;Il;IL-9;interleukin-9;P4;P40;p40 cytokine;p40 T-cell and mast cell growth factor;T-cell growth factor p40
Weitere Details:: Enables cytokine activity. Involved in positive regulation of interleukin-5 production. Acts upstream of or within several processes, including B cell activation; regulation of cellular protein metabolic process; and regulation of receptor signaling pathway via JAK-STAT. Located in extracellular space. Is expressed in gut; liver; thymus; and thymus primordium. Human ortholog(s) of this gene implicated in asthma and respiratory syncytial virus infectious disease. Orthologous to human IL9 (interleukin 9).